Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for Beta Folders 100 pts. 8,923
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 81 pts. 8,923
  3. Avatar for Contenders 3. Contenders 65 pts. 8,915
  4. Avatar for Go Science 4. Go Science 52 pts. 8,913
  5. Avatar for Void Crushers 5. Void Crushers 41 pts. 8,882
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 32 pts. 8,877
  7. Avatar for Gargleblasters 7. Gargleblasters 24 pts. 8,852
  8. Avatar for HMT heritage 8. HMT heritage 18 pts. 8,742
  9. Avatar for Deleted group 9. Deleted group pts. 8,721
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 10 pts. 8,662

  1. Avatar for nemo7731 31. nemo7731 Lv 1 54 pts. 8,777
  2. Avatar for sheerbliss 32. sheerbliss Lv 1 53 pts. 8,777
  3. Avatar for jermainiac 33. jermainiac Lv 1 51 pts. 8,774
  4. Avatar for Galaxie 34. Galaxie Lv 1 50 pts. 8,774
  5. Avatar for pvc78 35. pvc78 Lv 1 49 pts. 8,761
  6. Avatar for nicobul 36. nicobul Lv 1 48 pts. 8,760
  7. Avatar for gitwut 37. gitwut Lv 1 47 pts. 8,758
  8. Avatar for goastano 38. goastano Lv 1 46 pts. 8,756
  9. Avatar for Deleted player 39. Deleted player 45 pts. 8,753
  10. Avatar for Norrjane 40. Norrjane Lv 1 44 pts. 8,750

Comments