Placeholder image of a protein
Icon representing a puzzle

1188: Unsolved De-novo Freestyle 67

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 29, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TREQVKEFEKTIRNTDRVRVEIHGSDEMEVEWQRGDSRTVRHTKGEDEQTKELKKIFKRH

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 5 pts. 8,556
  2. Avatar for xkcd 12. xkcd 4 pts. 8,374
  3. Avatar for freefolder 13. freefolder 2 pts. 8,362
  4. Avatar for BOINC@Poland 14. BOINC@Poland 2 pts. 8,329
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,204
  6. Avatar for It's over 9000! 16. It's over 9000! 1 pt. 8,087
  7. Avatar for TS Biology 17. TS Biology 1 pt. 7,834
  8. Avatar for Czech National Team 18. Czech National Team 1 pt. 7,384
  9. Avatar for Deleted group 20. Deleted group pts. 6,575

  1. Avatar for spvincent
    1. spvincent Lv 1
    100 pts. 9,210
  2. Avatar for actiasluna 2. actiasluna Lv 1 98 pts. 9,133
  3. Avatar for Glen B 3. Glen B Lv 1 96 pts. 9,104
  4. Avatar for retiredmichael 4. retiredmichael Lv 1 94 pts. 9,095
  5. Avatar for mimi 5. mimi Lv 1 92 pts. 9,089
  6. Avatar for bertro 6. bertro Lv 1 90 pts. 9,053
  7. Avatar for gloverd 7. gloverd Lv 1 88 pts. 9,051
  8. Avatar for TomTaylor 8. TomTaylor Lv 1 86 pts. 9,037
  9. Avatar for Mark- 9. Mark- Lv 1 85 pts. 9,031
  10. Avatar for Madde 10. Madde Lv 1 83 pts. 9,028

Comments