Placeholder image of a protein
Icon representing a puzzle

1188: Unsolved De-novo Freestyle 67

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
January 29, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TREQVKEFEKTIRNTDRVRVEIHGSDEMEVEWQRGDSRTVRHTKGEDEQTKELKKIFKRH

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 5 pts. 8,556
  2. Avatar for xkcd 12. xkcd 4 pts. 8,374
  3. Avatar for freefolder 13. freefolder 2 pts. 8,362
  4. Avatar for BOINC@Poland 14. BOINC@Poland 2 pts. 8,329
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,204
  6. Avatar for It's over 9000! 16. It's over 9000! 1 pt. 8,087
  7. Avatar for TS Biology 17. TS Biology 1 pt. 7,834
  8. Avatar for Czech National Team 18. Czech National Team 1 pt. 7,384
  9. Avatar for Deleted group 20. Deleted group pts. 6,575

  1. Avatar for g_b 91. g_b Lv 1 9 pts. 8,464
  2. Avatar for fishercat 92. fishercat Lv 1 9 pts. 8,464
  3. Avatar for Tac1 93. Tac1 Lv 1 9 pts. 8,432
  4. Avatar for JUMELLE54 94. JUMELLE54 Lv 1 9 pts. 8,420
  5. Avatar for smholst 95. smholst Lv 1 8 pts. 8,411
  6. Avatar for proteansoup 96. proteansoup Lv 1 8 pts. 8,405
  7. Avatar for 01010011111 97. 01010011111 Lv 1 8 pts. 8,402
  8. Avatar for t012 99. t012 Lv 1 7 pts. 8,381
  9. Avatar for uihcv 100. uihcv Lv 1 7 pts. 8,379

Comments