Placeholder image of a protein
Icon representing a puzzle

1188: Unsolved De-novo Freestyle 67

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
January 29, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TREQVKEFEKTIRNTDRVRVEIHGSDEMEVEWQRGDSRTVRHTKGEDEQTKELKKIFKRH

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 5 pts. 8,556
  2. Avatar for xkcd 12. xkcd 4 pts. 8,374
  3. Avatar for freefolder 13. freefolder 2 pts. 8,362
  4. Avatar for BOINC@Poland 14. BOINC@Poland 2 pts. 8,329
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,204
  6. Avatar for It's over 9000! 16. It's over 9000! 1 pt. 8,087
  7. Avatar for TS Biology 17. TS Biology 1 pt. 7,834
  8. Avatar for Czech National Team 18. Czech National Team 1 pt. 7,384
  9. Avatar for Deleted group 20. Deleted group pts. 6,575

  1. Avatar for Graham MF 101. Graham MF Lv 1 7 pts. 8,378
  2. Avatar for LuapNor 102. LuapNor Lv 1 7 pts. 8,374
  3. Avatar for Mydogisa Toelicker 103. Mydogisa Toelicker Lv 1 6 pts. 8,365
  4. Avatar for Altercomp 104. Altercomp Lv 1 6 pts. 8,362
  5. Avatar for Truncheon Luncheon 105. Truncheon Luncheon Lv 1 6 pts. 8,360
  6. Avatar for Superphosphate 106. Superphosphate Lv 1 6 pts. 8,353
  7. Avatar for SKSbell 107. SKSbell Lv 1 5 pts. 8,351
  8. Avatar for NameChangeNeeded01 108. NameChangeNeeded01 Lv 1 5 pts. 8,346
  9. Avatar for joremen 109. joremen Lv 1 5 pts. 8,345
  10. Avatar for fryguy 110. fryguy Lv 1 5 pts. 8,334

Comments