Placeholder image of a protein
Icon representing a puzzle

1188: Unsolved De-novo Freestyle 67

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 29, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TREQVKEFEKTIRNTDRVRVEIHGSDEMEVEWQRGDSRTVRHTKGEDEQTKELKKIFKRH

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 5 pts. 8,556
  2. Avatar for xkcd 12. xkcd 4 pts. 8,374
  3. Avatar for freefolder 13. freefolder 2 pts. 8,362
  4. Avatar for BOINC@Poland 14. BOINC@Poland 2 pts. 8,329
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,204
  6. Avatar for It's over 9000! 16. It's over 9000! 1 pt. 8,087
  7. Avatar for TS Biology 17. TS Biology 1 pt. 7,834
  8. Avatar for Czech National Team 18. Czech National Team 1 pt. 7,384
  9. Avatar for Ms. Carter's Jr. Science Classes 19. Ms. Carter's Jr. Science Classes 1 pt. 6,683
  10. Avatar for Deleted group 20. Deleted group pts. 6,575
  1. Avatar for dahast.de 151. dahast.de Lv 1 1 pt. 7,844
  2. Avatar for Punktchen 152. Punktchen Lv 1 1 pt. 7,838
  3. Avatar for lildantipope 153. lildantipope Lv 1 1 pt. 7,834
  4. Avatar for dizzywings 154. dizzywings Lv 1 1 pt. 7,823
  5. Avatar for demeter900 155. demeter900 Lv 1 1 pt. 7,797
  6. Avatar for larry25427 156. larry25427 Lv 1 1 pt. 7,786
  7. Avatar for navn 157. navn Lv 1 1 pt. 7,777
  8. Avatar for ramzes203 158. ramzes203 Lv 1 1 pt. 7,766
  9. Avatar for NotJim99 159. NotJim99 Lv 1 1 pt. 7,743
  10. Avatar for Yaloros 160. Yaloros Lv 1 1 pt. 7,741

Comments