Placeholder image of a protein
Icon representing a puzzle

1188: Unsolved De-novo Freestyle 67

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
January 29, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TREQVKEFEKTIRNTDRVRVEIHGSDEMEVEWQRGDSRTVRHTKGEDEQTKELKKIFKRH

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 5 pts. 8,556
  2. Avatar for xkcd 12. xkcd 4 pts. 8,374
  3. Avatar for freefolder 13. freefolder 2 pts. 8,362
  4. Avatar for BOINC@Poland 14. BOINC@Poland 2 pts. 8,329
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,204
  6. Avatar for It's over 9000! 16. It's over 9000! 1 pt. 8,087
  7. Avatar for TS Biology 17. TS Biology 1 pt. 7,834
  8. Avatar for Czech National Team 18. Czech National Team 1 pt. 7,384
  9. Avatar for Deleted group 20. Deleted group pts. 6,575

  1. Avatar for Shannon Aga 211. Shannon Aga Lv 1 1 pt. 6,263
  2. Avatar for Schleicher 212. Schleicher Lv 1 1 pt. 6,263
  3. Avatar for Odog319 213. Odog319 Lv 1 1 pt. 6,259
  4. Avatar for CubicB 214. CubicB Lv 1 1 pt. 6,150
  5. Avatar for bgrassy 215. bgrassy Lv 1 1 pt. 6,008
  6. Avatar for UnclePeeH 216. UnclePeeH Lv 1 1 pt. 5,945
  7. Avatar for JellyfishCoder 217. JellyfishCoder Lv 1 1 pt. 5,546
  8. Avatar for DrakeSnarski 218. DrakeSnarski Lv 1 1 pt. 4,841
  9. Avatar for meburke 219. meburke Lv 1 1 pt. 4,840
  10. Avatar for aspadistra 220. aspadistra Lv 1 1 pt. 4,595

Comments