Placeholder image of a protein
Icon representing a puzzle

1188: Unsolved De-novo Freestyle 67

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 29, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TREQVKEFEKTIRNTDRVRVEIHGSDEMEVEWQRGDSRTVRHTKGEDEQTKELKKIFKRH

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 5 pts. 8,556
  2. Avatar for xkcd 12. xkcd 4 pts. 8,374
  3. Avatar for freefolder 13. freefolder 2 pts. 8,362
  4. Avatar for BOINC@Poland 14. BOINC@Poland 2 pts. 8,329
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,204
  6. Avatar for It's over 9000! 16. It's over 9000! 1 pt. 8,087
  7. Avatar for TS Biology 17. TS Biology 1 pt. 7,834
  8. Avatar for Czech National Team 18. Czech National Team 1 pt. 7,384
  9. Avatar for Ms. Carter's Jr. Science Classes 19. Ms. Carter's Jr. Science Classes 1 pt. 6,683
  10. Avatar for Deleted group 20. Deleted group pts. 6,575
  1. Avatar for JCBio162 221. JCBio162 Lv 1 1 pt. 0
  2. Avatar for Soweli 222. Soweli Lv 1 1 pt. 0
  3. Avatar for Antibrad 223. Antibrad Lv 1 1 pt. 0
  4. Avatar for bob1928 224. bob1928 Lv 1 1 pt. 0
  5. Avatar for BeckerM 225. BeckerM Lv 1 1 pt. 0
  6. Avatar for Mike Cassidy 226. Mike Cassidy Lv 1 1 pt. 0
  7. Avatar for crpainter 227. crpainter Lv 1 1 pt. 0
  8. Avatar for affecaffe 228. affecaffe Lv 1 1 pt. 0
  9. Avatar for atlas100 229. atlas100 Lv 1 1 pt. 0
  10. Avatar for petetrig 230. petetrig Lv 1 1 pt. 0

Comments