Placeholder image of a protein
Icon representing a puzzle

1188: Unsolved De-novo Freestyle 67

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
January 29, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TREQVKEFEKTIRNTDRVRVEIHGSDEMEVEWQRGDSRTVRHTKGEDEQTKELKKIFKRH

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 5 pts. 8,556
  2. Avatar for xkcd 12. xkcd 4 pts. 8,374
  3. Avatar for freefolder 13. freefolder 2 pts. 8,362
  4. Avatar for BOINC@Poland 14. BOINC@Poland 2 pts. 8,329
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,204
  6. Avatar for It's over 9000! 16. It's over 9000! 1 pt. 8,087
  7. Avatar for TS Biology 17. TS Biology 1 pt. 7,834
  8. Avatar for Czech National Team 18. Czech National Team 1 pt. 7,384
  9. Avatar for Ms. Carter's Jr. Science Classes 19. Ms. Carter's Jr. Science Classes 1 pt. 6,683
  10. Avatar for Deleted group 20. Deleted group pts. 6,575
  1. Avatar for phi16 21. phi16 Lv 1 65 pts. 8,961
  2. Avatar for Scopper 22. Scopper Lv 1 63 pts. 8,956
  3. Avatar for Timo van der Laan 23. Timo van der Laan Lv 1 62 pts. 8,951
  4. Avatar for Blipperman 24. Blipperman Lv 1 60 pts. 8,951
  5. Avatar for Bletchley Park 25. Bletchley Park Lv 1 59 pts. 8,941
  6. Avatar for O Seki To 26. O Seki To Lv 1 57 pts. 8,935
  7. Avatar for steveB 27. steveB Lv 1 56 pts. 8,932
  8. Avatar for johnmitch 28. johnmitch Lv 1 55 pts. 8,917
  9. Avatar for isaksson 29. isaksson Lv 1 54 pts. 8,911
  10. Avatar for drumpeter18yrs9yrs 30. drumpeter18yrs9yrs Lv 1 52 pts. 8,908

Comments