Placeholder image of a protein
Icon representing a puzzle

1188: Unsolved De-novo Freestyle 67

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 29, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TREQVKEFEKTIRNTDRVRVEIHGSDEMEVEWQRGDSRTVRHTKGEDEQTKELKKIFKRH

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 5 pts. 8,556
  2. Avatar for xkcd 12. xkcd 4 pts. 8,374
  3. Avatar for freefolder 13. freefolder 2 pts. 8,362
  4. Avatar for BOINC@Poland 14. BOINC@Poland 2 pts. 8,329
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,204
  6. Avatar for It's over 9000! 16. It's over 9000! 1 pt. 8,087
  7. Avatar for TS Biology 17. TS Biology 1 pt. 7,834
  8. Avatar for Czech National Team 18. Czech National Team 1 pt. 7,384
  9. Avatar for Ms. Carter's Jr. Science Classes 19. Ms. Carter's Jr. Science Classes 1 pt. 6,683
  10. Avatar for Deleted group 20. Deleted group pts. 6,575
  1. Avatar for christioanchauvin 41. christioanchauvin Lv 1 40 pts. 8,868
  2. Avatar for dcrwheeler 42. dcrwheeler Lv 1 39 pts. 8,860
  3. Avatar for Skippysk8s 43. Skippysk8s Lv 1 38 pts. 8,854
  4. Avatar for lynnai 44. lynnai Lv 1 37 pts. 8,832
  5. Avatar for diamond_dust 45. diamond_dust Lv 1 36 pts. 8,831
  6. Avatar for Anfinsen_slept_here 46. Anfinsen_slept_here Lv 1 35 pts. 8,811
  7. Avatar for Deleted player 47. Deleted player 34 pts. 8,798
  8. Avatar for pmdpmd 48. pmdpmd Lv 1 33 pts. 8,784
  9. Avatar for uhuuhu 49. uhuuhu Lv 1 32 pts. 8,778
  10. Avatar for alcor29 50. alcor29 Lv 1 32 pts. 8,777

Comments