Placeholder image of a protein
Icon representing a puzzle

1188: Unsolved De-novo Freestyle 67

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 29, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TREQVKEFEKTIRNTDRVRVEIHGSDEMEVEWQRGDSRTVRHTKGEDEQTKELKKIFKRH

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 5 pts. 8,556
  2. Avatar for xkcd 12. xkcd 4 pts. 8,374
  3. Avatar for freefolder 13. freefolder 2 pts. 8,362
  4. Avatar for BOINC@Poland 14. BOINC@Poland 2 pts. 8,329
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,204
  6. Avatar for It's over 9000! 16. It's over 9000! 1 pt. 8,087
  7. Avatar for TS Biology 17. TS Biology 1 pt. 7,834
  8. Avatar for Czech National Team 18. Czech National Team 1 pt. 7,384
  9. Avatar for Ms. Carter's Jr. Science Classes 19. Ms. Carter's Jr. Science Classes 1 pt. 6,683
  10. Avatar for Deleted group 20. Deleted group pts. 6,575
  1. Avatar for Mike Lewis 61. Mike Lewis Lv 1 23 pts. 8,659
  2. Avatar for Bushman 62. Bushman Lv 1 23 pts. 8,659
  3. Avatar for ViJay7019 63. ViJay7019 Lv 1 22 pts. 8,650
  4. Avatar for goastano 64. goastano Lv 1 22 pts. 8,648
  5. Avatar for ManVsYard 65. ManVsYard Lv 1 21 pts. 8,643
  6. Avatar for bx7gn 66. bx7gn Lv 1 20 pts. 8,641
  7. Avatar for dpmattingly 67. dpmattingly Lv 1 20 pts. 8,634
  8. Avatar for benrh 68. benrh Lv 1 19 pts. 8,634
  9. Avatar for hansvandenhof 69. hansvandenhof Lv 1 19 pts. 8,624
  10. Avatar for bendbob 70. bendbob Lv 1 18 pts. 8,619

Comments