Placeholder image of a protein
Icon representing a puzzle

1188: Unsolved De-novo Freestyle 67

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 29, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TREQVKEFEKTIRNTDRVRVEIHGSDEMEVEWQRGDSRTVRHTKGEDEQTKELKKIFKRH

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 5 pts. 8,556
  2. Avatar for xkcd 12. xkcd 4 pts. 8,374
  3. Avatar for freefolder 13. freefolder 2 pts. 8,362
  4. Avatar for BOINC@Poland 14. BOINC@Poland 2 pts. 8,329
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,204
  6. Avatar for It's over 9000! 16. It's over 9000! 1 pt. 8,087
  7. Avatar for TS Biology 17. TS Biology 1 pt. 7,834
  8. Avatar for Czech National Team 18. Czech National Team 1 pt. 7,384
  9. Avatar for Ms. Carter's Jr. Science Classes 19. Ms. Carter's Jr. Science Classes 1 pt. 6,683
  10. Avatar for Deleted group 20. Deleted group pts. 6,575
  1. Avatar for Giant Berk 71. Giant Berk Lv 1 18 pts. 8,615
  2. Avatar for caglar 72. caglar Lv 1 17 pts. 8,614
  3. Avatar for opiorfina 73. opiorfina Lv 1 17 pts. 8,613
  4. Avatar for cbwest 74. cbwest Lv 1 16 pts. 8,611
  5. Avatar for harvardman 75. harvardman Lv 1 16 pts. 8,604
  6. Avatar for WarpSpeed 76. WarpSpeed Lv 1 15 pts. 8,583
  7. Avatar for WBarme1234 77. WBarme1234 Lv 1 15 pts. 8,569
  8. Avatar for smilingone 78. smilingone Lv 1 14 pts. 8,561
  9. Avatar for jamiexq 79. jamiexq Lv 1 14 pts. 8,556
  10. Avatar for Mr_Jolty 80. Mr_Jolty Lv 1 13 pts. 8,556

Comments