Placeholder image of a protein
Icon representing a puzzle

1188: Unsolved De-novo Freestyle 67

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 29, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TREQVKEFEKTIRNTDRVRVEIHGSDEMEVEWQRGDSRTVRHTKGEDEQTKELKKIFKRH

Top groups

  1. Avatar for SETI.Germany 21. SETI.Germany 1 pt. 6,263
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 4,595
  3. Avatar for JCBio162 23. JCBio162 1 pt. 0
  1. Avatar for spvincent
    1. spvincent Lv 1
    100 pts. 9,210
  2. Avatar for actiasluna 2. actiasluna Lv 1 98 pts. 9,133
  3. Avatar for Glen B 3. Glen B Lv 1 96 pts. 9,104
  4. Avatar for retiredmichael 4. retiredmichael Lv 1 94 pts. 9,095
  5. Avatar for mimi 5. mimi Lv 1 92 pts. 9,089
  6. Avatar for bertro 6. bertro Lv 1 90 pts. 9,053
  7. Avatar for gloverd 7. gloverd Lv 1 88 pts. 9,051
  8. Avatar for TomTaylor 8. TomTaylor Lv 1 86 pts. 9,037
  9. Avatar for Mark- 9. Mark- Lv 1 85 pts. 9,031
  10. Avatar for Madde 10. Madde Lv 1 83 pts. 9,028

Comments