Placeholder image of a protein
Icon representing a puzzle

1188: Unsolved De-novo Freestyle 67

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 29, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TREQVKEFEKTIRNTDRVRVEIHGSDEMEVEWQRGDSRTVRHTKGEDEQTKELKKIFKRH

Top groups


  1. Avatar for Contenders 100 pts. 9,220
  2. Avatar for Gargleblasters 2. Gargleblasters 80 pts. 9,140
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,095
  4. Avatar for Go Science 4. Go Science 49 pts. 9,051
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 37 pts. 9,029
  6. Avatar for Void Crushers 6. Void Crushers 28 pts. 9,028
  7. Avatar for HMT heritage 7. HMT heritage 21 pts. 8,935
  8. Avatar for Deleted group 8. Deleted group pts. 8,908
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 11 pts. 8,901
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 8,776

  1. Avatar for spvincent
    1. spvincent Lv 1
    100 pts. 9,210
  2. Avatar for actiasluna 2. actiasluna Lv 1 98 pts. 9,133
  3. Avatar for Glen B 3. Glen B Lv 1 96 pts. 9,104
  4. Avatar for retiredmichael 4. retiredmichael Lv 1 94 pts. 9,095
  5. Avatar for mimi 5. mimi Lv 1 92 pts. 9,089
  6. Avatar for bertro 6. bertro Lv 1 90 pts. 9,053
  7. Avatar for gloverd 7. gloverd Lv 1 88 pts. 9,051
  8. Avatar for TomTaylor 8. TomTaylor Lv 1 86 pts. 9,037
  9. Avatar for Mark- 9. Mark- Lv 1 85 pts. 9,031
  10. Avatar for Madde 10. Madde Lv 1 83 pts. 9,028

Comments