Placeholder image of a protein
Icon representing a puzzle

1188: Unsolved De-novo Freestyle 67

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
January 29, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TREQVKEFEKTIRNTDRVRVEIHGSDEMEVEWQRGDSRTVRHTKGEDEQTKELKKIFKRH

Top groups


  1. Avatar for Contenders 100 pts. 9,220
  2. Avatar for Gargleblasters 2. Gargleblasters 80 pts. 9,140
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,095
  4. Avatar for Go Science 4. Go Science 49 pts. 9,051
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 37 pts. 9,029
  6. Avatar for Void Crushers 6. Void Crushers 28 pts. 9,028
  7. Avatar for HMT heritage 7. HMT heritage 21 pts. 8,935
  8. Avatar for Deleted group 8. Deleted group pts. 8,908
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 11 pts. 8,901
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 8,776

  1. Avatar for christioanchauvin 41. christioanchauvin Lv 1 40 pts. 8,868
  2. Avatar for dcrwheeler 42. dcrwheeler Lv 1 39 pts. 8,860
  3. Avatar for Skippysk8s 43. Skippysk8s Lv 1 38 pts. 8,854
  4. Avatar for lynnai 44. lynnai Lv 1 37 pts. 8,832
  5. Avatar for diamond_dust 45. diamond_dust Lv 1 36 pts. 8,831
  6. Avatar for Anfinsen_slept_here 46. Anfinsen_slept_here Lv 1 35 pts. 8,811
  7. Avatar for Deleted player 47. Deleted player 34 pts. 8,798
  8. Avatar for pmdpmd 48. pmdpmd Lv 1 33 pts. 8,784
  9. Avatar for uhuuhu 49. uhuuhu Lv 1 32 pts. 8,778
  10. Avatar for alcor29 50. alcor29 Lv 1 32 pts. 8,777

Comments