Placeholder image of a protein
Icon representing a puzzle

1189: Revisiting Puzzle 136: Cell Adhesion

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
February 03, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 4 pts. 9,226
  2. Avatar for BOINC@Poland 12. BOINC@Poland 3 pts. 9,103
  3. Avatar for Russian team 13. Russian team 2 pts. 9,065
  4. Avatar for Deleted group 14. Deleted group pts. 8,986
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 8,862
  6. Avatar for xkcd 16. xkcd 1 pt. 8,856
  7. Avatar for freefolder 17. freefolder 1 pt. 8,303
  8. Avatar for Eὕρηκα! Heureka! 18. Eὕρηκα! Heureka! 1 pt. 8,078
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 7,504

  1. Avatar for Alistair69 121. Alistair69 Lv 1 4 pts. 8,671
  2. Avatar for fryguy 122. fryguy Lv 1 4 pts. 8,661
  3. Avatar for greepski 123. greepski Lv 1 4 pts. 8,658
  4. Avatar for Giant Berk 124. Giant Berk Lv 1 3 pts. 8,650
  5. Avatar for TJOK fan 125. TJOK fan Lv 1 3 pts. 8,642
  6. Avatar for JUMELLE54 126. JUMELLE54 Lv 1 3 pts. 8,619
  7. Avatar for cherry39 127. cherry39 Lv 1 3 pts. 8,545
  8. Avatar for arginia 128. arginia Lv 1 3 pts. 8,526
  9. Avatar for Mike Cassidy 129. Mike Cassidy Lv 1 3 pts. 8,518
  10. Avatar for 01010011111 130. 01010011111 Lv 1 3 pts. 8,481

Comments


brow42 Lv 1

I'd be interested in knowing what that pro-x-x-pro-x-x-pro, x hydrophilic forms when the puzzle closes. As a helix it makes a nice stripe. A polyproline helix that moved to the surface? The prolines could form a highly specific interaction zone, but hydrophillics keep it facing inward. A true alpha helix with full h-bonds would be preferred, so why are the prolines conserved?

I suppose it's probably just a disordered loop but the pattern is very suggestive.

bkoep Staff Lv 1

Very interesting question, brow42! As you say, proline is unfavored for alpha helices and beta sheets, because its amino group cannot make the hydrogen bonds that stabilize those secondary structures. Indeed, the proline regions of this protein do not form any regular secondary structure.

I dug a little deeper into this particular protein. While proline is not strictly conserved at these sites in related proteins, these proteins do tend to be proline-rich. And in fact, these proteins adopt—not disordered loops—but surprisingly ordered loops. In fact, some of these "secondary structure-less" proteins have even been crystallized!

My guess is that the prolines actually serve to disfavor alternate conformations of this protein. By destabilizing alpha helices and beta sheets, the prolines can make this loopy structure the most stable option.