Placeholder image of a protein
Icon representing a puzzle

1189: Revisiting Puzzle 136: Cell Adhesion

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
February 03, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups


  1. Avatar for Gargleblasters 100 pts. 9,586
  2. Avatar for Beta Folders 2. Beta Folders 79 pts. 9,586
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 61 pts. 9,553
  4. Avatar for Contenders 4. Contenders 47 pts. 9,543
  5. Avatar for Go Science 5. Go Science 35 pts. 9,522
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 26 pts. 9,489
  7. Avatar for HMT heritage 7. HMT heritage 19 pts. 9,435
  8. Avatar for Void Crushers 8. Void Crushers 14 pts. 9,412
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 10 pts. 9,392
  10. Avatar for Deleted group 10. Deleted group pts. 9,380

  1. Avatar for MaartenDesnouck 131. MaartenDesnouck Lv 1 3 pts. 8,477
  2. Avatar for Greenlee 132. Greenlee Lv 1 3 pts. 8,465
  3. Avatar for Auntecedent 133. Auntecedent Lv 1 3 pts. 8,451
  4. Avatar for armaholik 134. armaholik Lv 1 2 pts. 8,421
  5. Avatar for navn 135. navn Lv 1 2 pts. 8,416
  6. Avatar for Altejos349 136. Altejos349 Lv 1 2 pts. 8,386
  7. Avatar for rg_sar 137. rg_sar Lv 1 2 pts. 8,355
  8. Avatar for Colostomy EXPLOSION. 138. Colostomy EXPLOSION. Lv 1 2 pts. 8,350
  9. Avatar for SouperGenious 139. SouperGenious Lv 1 2 pts. 8,347
  10. Avatar for Ernst Zundel 140. Ernst Zundel Lv 1 2 pts. 8,328

Comments


brow42 Lv 1

I'd be interested in knowing what that pro-x-x-pro-x-x-pro, x hydrophilic forms when the puzzle closes. As a helix it makes a nice stripe. A polyproline helix that moved to the surface? The prolines could form a highly specific interaction zone, but hydrophillics keep it facing inward. A true alpha helix with full h-bonds would be preferred, so why are the prolines conserved?

I suppose it's probably just a disordered loop but the pattern is very suggestive.

bkoep Staff Lv 1

Very interesting question, brow42! As you say, proline is unfavored for alpha helices and beta sheets, because its amino group cannot make the hydrogen bonds that stabilize those secondary structures. Indeed, the proline regions of this protein do not form any regular secondary structure.

I dug a little deeper into this particular protein. While proline is not strictly conserved at these sites in related proteins, these proteins do tend to be proline-rich. And in fact, these proteins adopt—not disordered loops—but surprisingly ordered loops. In fact, some of these "secondary structure-less" proteins have even been crystallized!

My guess is that the prolines actually serve to disfavor alternate conformations of this protein. By destabilizing alpha helices and beta sheets, the prolines can make this loopy structure the most stable option.