Placeholder image of a protein
Icon representing a puzzle

1190: Unsolved De-novo Freestyle 68

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 05, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKTIHEELVKKMKEEVKKIKKKGDGDVRMDLEVRNGRSVRIKVEIRGSTQLELEVRVEK

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 6,985
  2. Avatar for Team Schleswig-Holstein 22. Team Schleswig-Holstein 1 pt. 6,455
  1. Avatar for Scopper
    1. Scopper Lv 1
    100 pts. 9,515
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 89 pts. 9,515
  3. Avatar for pauldunn 3. pauldunn Lv 1 78 pts. 9,513
  4. Avatar for diamond_dust 4. diamond_dust Lv 1 69 pts. 9,513
  5. Avatar for gloverd 5. gloverd Lv 1 60 pts. 9,513
  6. Avatar for penteplayer 6. penteplayer Lv 1 53 pts. 9,513
  7. Avatar for sheerbliss 7. sheerbliss Lv 1 46 pts. 9,508
  8. Avatar for reefyrob 8. reefyrob Lv 1 40 pts. 9,508
  9. Avatar for smilingone 9. smilingone Lv 1 34 pts. 9,504
  10. Avatar for LociOiling 10. LociOiling Lv 1 29 pts. 9,504

Comments