Placeholder image of a protein
Icon representing a puzzle

1190: Unsolved De-novo Freestyle 68

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 05, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKTIHEELVKKMKEEVKKIKKKGDGDVRMDLEVRNGRSVRIKVEIRGSTQLELEVRVEK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,515
  2. Avatar for Beta Folders 2. Beta Folders 79 pts. 9,508
  3. Avatar for Contenders 3. Contenders 61 pts. 9,503
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 47 pts. 9,495
  5. Avatar for Void Crushers 5. Void Crushers 35 pts. 9,437
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 26 pts. 9,419
  7. Avatar for Gargleblasters 7. Gargleblasters 19 pts. 9,366
  8. Avatar for HMT heritage 8. HMT heritage 14 pts. 9,296
  9. Avatar for Deleted group 9. Deleted group pts. 9,268
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 9,060
  1. Avatar for Bletchley Park 11. Bletchley Park Lv 1 25 pts. 9,503
  2. Avatar for bertro 12. bertro Lv 1 21 pts. 9,503
  3. Avatar for retiredmichael 13. retiredmichael Lv 1 18 pts. 9,500
  4. Avatar for mimi 14. mimi Lv 1 15 pts. 9,500
  5. Avatar for Deleted player 15. Deleted player pts. 9,499
  6. Avatar for brgreening 16. brgreening Lv 1 11 pts. 9,498
  7. Avatar for gitwut 17. gitwut Lv 1 9 pts. 9,497
  8. Avatar for Galaxie 18. Galaxie Lv 1 7 pts. 9,495
  9. Avatar for Terafold 19. Terafold Lv 1 6 pts. 9,486
  10. Avatar for lamoille 20. lamoille Lv 1 5 pts. 9,480

Comments