Placeholder image of a protein
Icon representing a puzzle

1190: Unsolved De-novo Freestyle 68

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
February 05, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKTIHEELVKKMKEEVKKIKKKGDGDVRMDLEVRNGRSVRIKVEIRGSTQLELEVRVEK

Top groups


  1. Avatar for Go Science 100 pts. 9,515
  2. Avatar for Beta Folders 2. Beta Folders 79 pts. 9,508
  3. Avatar for Contenders 3. Contenders 61 pts. 9,503
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 47 pts. 9,495
  5. Avatar for Void Crushers 5. Void Crushers 35 pts. 9,437
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 26 pts. 9,419
  7. Avatar for Gargleblasters 7. Gargleblasters 19 pts. 9,366
  8. Avatar for HMT heritage 8. HMT heritage 14 pts. 9,296
  9. Avatar for Deleted group 9. Deleted group pts. 9,268
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 9,060

  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 9,515
  2. Avatar for retiredmichael 2. retiredmichael Lv 1 98 pts. 9,504
  3. Avatar for Mark- 3. Mark- Lv 1 96 pts. 9,493
  4. Avatar for Galaxie 4. Galaxie Lv 1 94 pts. 9,476
  5. Avatar for WarpSpeed 5. WarpSpeed Lv 1 92 pts. 9,463
  6. Avatar for bertro 6. bertro Lv 1 90 pts. 9,457
  7. Avatar for gmn 7. gmn Lv 1 88 pts. 9,453
  8. Avatar for Timo van der Laan 8. Timo van der Laan Lv 1 86 pts. 9,437
  9. Avatar for Susume 9. Susume Lv 1 84 pts. 9,435
  10. Avatar for diamond_dust 10. diamond_dust Lv 1 82 pts. 9,429

Comments