Placeholder image of a protein
Icon representing a puzzle

1190: Unsolved De-novo Freestyle 68

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 05, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKTIHEELVKKMKEEVKKIKKKGDGDVRMDLEVRNGRSVRIKVEIRGSTQLELEVRVEK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,515
  2. Avatar for Beta Folders 2. Beta Folders 79 pts. 9,508
  3. Avatar for Contenders 3. Contenders 61 pts. 9,503
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 47 pts. 9,495
  5. Avatar for Void Crushers 5. Void Crushers 35 pts. 9,437
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 26 pts. 9,419
  7. Avatar for Gargleblasters 7. Gargleblasters 19 pts. 9,366
  8. Avatar for HMT heritage 8. HMT heritage 14 pts. 9,296
  9. Avatar for Deleted group 9. Deleted group pts. 9,268
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 9,060
  1. Avatar for Graham MF 111. Graham MF Lv 1 4 pts. 8,648
  2. Avatar for froggs554 112. froggs554 Lv 1 4 pts. 8,644
  3. Avatar for zo3xiaJonWeinberg 113. zo3xiaJonWeinberg Lv 1 3 pts. 8,639
  4. Avatar for hada 114. hada Lv 1 3 pts. 8,639
  5. Avatar for uihcv 115. uihcv Lv 1 3 pts. 8,638
  6. Avatar for Giant Berk 116. Giant Berk Lv 1 3 pts. 8,616
  7. Avatar for nagistick 117. nagistick Lv 1 3 pts. 8,604
  8. Avatar for Mike Lewis 118. Mike Lewis Lv 1 3 pts. 8,568
  9. Avatar for Jajaboman 119. Jajaboman Lv 1 3 pts. 8,554
  10. Avatar for smholst 120. smholst Lv 1 3 pts. 8,530

Comments