Placeholder image of a protein
Icon representing a puzzle

1192: Revisiting Puzzle 137: Rosetta Decoy

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
February 10, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 10 pts. 9,738
  2. Avatar for Deleted group 12. Deleted group pts. 9,582
  3. Avatar for It's over 9000! 13. It's over 9000! 6 pts. 9,536
  4. Avatar for freefolder 14. freefolder 4 pts. 9,486
  5. Avatar for Natural Abilities 15. Natural Abilities 3 pts. 9,475
  6. Avatar for Russian team 16. Russian team 2 pts. 9,450
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 2 pts. 9,370
  8. Avatar for xkcd 18. xkcd 1 pt. 9,352
  9. Avatar for foldeRNA 19. foldeRNA 1 pt. 9,290
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 9,181

  1. Avatar for Vinara 101. Vinara Lv 1 6 pts. 9,540
  2. Avatar for leehaggis 102. leehaggis Lv 1 6 pts. 9,540
  3. Avatar for Inkedhands 103. Inkedhands Lv 1 6 pts. 9,539
  4. Avatar for jebbiek 104. jebbiek Lv 1 5 pts. 9,536
  5. Avatar for BCAA 105. BCAA Lv 1 5 pts. 9,536
  6. Avatar for Greenlee 106. Greenlee Lv 1 5 pts. 9,532
  7. Avatar for Colostomy EXPLOSION. 107. Colostomy EXPLOSION. Lv 1 5 pts. 9,531
  8. Avatar for ManVsYard 108. ManVsYard Lv 1 5 pts. 9,529
  9. Avatar for Pro Lapser 109. Pro Lapser Lv 1 5 pts. 9,525
  10. Avatar for Truncheon Luncheon 110. Truncheon Luncheon Lv 1 4 pts. 9,516

Comments