Placeholder image of a protein
Icon representing a puzzle

1192: Revisiting Puzzle 137: Rosetta Decoy

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
February 10, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups


  1. Avatar for Contenders 100 pts. 9,934
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 83 pts. 9,895
  3. Avatar for Beta Folders 3. Beta Folders 69 pts. 9,873
  4. Avatar for Gargleblasters 4. Gargleblasters 56 pts. 9,870
  5. Avatar for Go Science 5. Go Science 45 pts. 9,865
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 36 pts. 9,808
  7. Avatar for HMT heritage 7. HMT heritage 29 pts. 9,790
  8. Avatar for Void Crushers 8. Void Crushers 23 pts. 9,790
  9. Avatar for Deleted group 9. Deleted group pts. 9,776
  10. Avatar for BOINC@Poland 10. BOINC@Poland 14 pts. 9,748

  1. Avatar for aspadistra 171. aspadistra Lv 1 1 pt. 9,181
  2. Avatar for ErazorOne 172. ErazorOne Lv 1 1 pt. 9,152
  3. Avatar for Ronin-Sensei 173. Ronin-Sensei Lv 1 1 pt. 9,135
  4. Avatar for momadoc 174. momadoc Lv 1 1 pt. 9,133
  5. Avatar for Bithalbierer 175. Bithalbierer Lv 1 1 pt. 9,131
  6. Avatar for AsDawnBreaks 176. AsDawnBreaks Lv 1 1 pt. 9,121
  7. Avatar for gurch 177. gurch Lv 1 1 pt. 9,119
  8. Avatar for etinuade 178. etinuade Lv 1 1 pt. 9,116
  9. Avatar for isantheautumn 179. isantheautumn Lv 1 1 pt. 9,113
  10. Avatar for nedi 180. nedi Lv 1 1 pt. 9,111

Comments