Placeholder image of a protein
Icon representing a puzzle

1194: Unsolved De-novo Freestyle 69

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 13, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DTNEVEKLEKMVREIQKLNGVEIEVERRDNTIRVQLRLDKEEVRIEIRTKEEVIRKVKELFKKIKELVRE

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 13 pts. 8,797
  2. Avatar for xkcd 12. xkcd 10 pts. 8,719
  3. Avatar for It's over 9000! 13. It's over 9000! 7 pts. 8,585
  4. Avatar for Natural Abilities 14. Natural Abilities 6 pts. 8,568
  5. Avatar for SETI.Germany 15. SETI.Germany 4 pts. 8,542
  6. Avatar for freefolder 16. freefolder 3 pts. 8,478
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 2 pts. 8,128
  8. Avatar for CHS SGF,MO 18. CHS SGF,MO 2 pts. 7,624
  9. Avatar for Team Schleswig-Holstein 19. Team Schleswig-Holstein 1 pt. 7,582
  10. Avatar for uneRx 20. uneRx 1 pt. 7,569
  1. Avatar for Blipperman
    1. Blipperman Lv 1
    100 pts. 9,421
  2. Avatar for actiasluna 2. actiasluna Lv 1 89 pts. 9,419
  3. Avatar for Skippysk8s 3. Skippysk8s Lv 1 78 pts. 9,416
  4. Avatar for diamond_dust 4. diamond_dust Lv 1 68 pts. 9,416
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 60 pts. 9,415
  6. Avatar for ManVsYard 6. ManVsYard Lv 1 52 pts. 9,415
  7. Avatar for andrewxc 7. andrewxc Lv 1 45 pts. 9,414
  8. Avatar for Cyberkashi 8. Cyberkashi Lv 1 39 pts. 9,412
  9. Avatar for pauldunn 9. pauldunn Lv 1 33 pts. 9,406
  10. Avatar for gloverd 10. gloverd Lv 1 28 pts. 9,390

Comments