Placeholder image of a protein
Icon representing a puzzle

1194: Unsolved De-novo Freestyle 69

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
February 13, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DTNEVEKLEKMVREIQKLNGVEIEVERRDNTIRVQLRLDKEEVRIEIRTKEEVIRKVKELFKKIKELVRE

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 13 pts. 8,797
  2. Avatar for xkcd 12. xkcd 10 pts. 8,719
  3. Avatar for It's over 9000! 13. It's over 9000! 7 pts. 8,585
  4. Avatar for Natural Abilities 14. Natural Abilities 6 pts. 8,568
  5. Avatar for SETI.Germany 15. SETI.Germany 4 pts. 8,542
  6. Avatar for freefolder 16. freefolder 3 pts. 8,478
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 2 pts. 8,128
  8. Avatar for CHS SGF,MO 18. CHS SGF,MO 2 pts. 7,624
  9. Avatar for uneRx 20. uneRx 1 pt. 7,569

  1. Avatar for frood66
    1. frood66 Lv 1
    100 pts. 9,417
  2. Avatar for Mark- 2. Mark- Lv 1 99 pts. 9,361
  3. Avatar for gmn 3. gmn Lv 1 97 pts. 9,331
  4. Avatar for diamond_dust 4. diamond_dust Lv 1 95 pts. 9,306
  5. Avatar for BrKapr 5. BrKapr Lv 1 93 pts. 9,303
  6. Avatar for retiredmichael 6. retiredmichael Lv 1 91 pts. 9,301
  7. Avatar for Deleted player 7. Deleted player pts. 9,291
  8. Avatar for jermainiac 8. jermainiac Lv 1 87 pts. 9,280
  9. Avatar for O Seki To 9. O Seki To Lv 1 85 pts. 9,277
  10. Avatar for mimi 10. mimi Lv 1 84 pts. 9,251

Comments