Placeholder image of a protein
Icon representing a puzzle

1194: Unsolved De-novo Freestyle 69

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 13, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DTNEVEKLEKMVREIQKLNGVEIEVERRDNTIRVQLRLDKEEVRIEIRTKEEVIRKVKELFKKIKELVRE

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 13 pts. 8,797
  2. Avatar for xkcd 12. xkcd 10 pts. 8,719
  3. Avatar for It's over 9000! 13. It's over 9000! 7 pts. 8,585
  4. Avatar for Natural Abilities 14. Natural Abilities 6 pts. 8,568
  5. Avatar for SETI.Germany 15. SETI.Germany 4 pts. 8,542
  6. Avatar for freefolder 16. freefolder 3 pts. 8,478
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 2 pts. 8,128
  8. Avatar for CHS SGF,MO 18. CHS SGF,MO 2 pts. 7,624
  9. Avatar for Team Schleswig-Holstein 19. Team Schleswig-Holstein 1 pt. 7,582
  10. Avatar for uneRx 20. uneRx 1 pt. 7,569
  1. Avatar for BackBuffer 121. BackBuffer Lv 1 4 pts. 8,433
  2. Avatar for uihcv 122. uihcv Lv 1 4 pts. 8,403
  3. Avatar for boondog 123. boondog Lv 1 4 pts. 8,352
  4. Avatar for senor pit 124. senor pit Lv 1 4 pts. 8,332
  5. Avatar for NotJim99 125. NotJim99 Lv 1 4 pts. 8,258
  6. Avatar for tela 126. tela Lv 1 4 pts. 8,236
  7. Avatar for harvardman 127. harvardman Lv 1 4 pts. 8,226
  8. Avatar for SouperGenious 128. SouperGenious Lv 1 3 pts. 8,225
  9. Avatar for Tommy Turtle 129. Tommy Turtle Lv 1 3 pts. 8,215
  10. Avatar for Auntecedent 130. Auntecedent Lv 1 3 pts. 8,191

Comments