Placeholder image of a protein
Icon representing a puzzle

1194: Unsolved De-novo Freestyle 69

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
February 13, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DTNEVEKLEKMVREIQKLNGVEIEVERRDNTIRVQLRLDKEEVRIEIRTKEEVIRKVKELFKKIKELVRE

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 13 pts. 8,797
  2. Avatar for xkcd 12. xkcd 10 pts. 8,719
  3. Avatar for It's over 9000! 13. It's over 9000! 7 pts. 8,585
  4. Avatar for Natural Abilities 14. Natural Abilities 6 pts. 8,568
  5. Avatar for SETI.Germany 15. SETI.Germany 4 pts. 8,542
  6. Avatar for freefolder 16. freefolder 3 pts. 8,478
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 2 pts. 8,128
  8. Avatar for CHS SGF,MO 18. CHS SGF,MO 2 pts. 7,624
  9. Avatar for uneRx 20. uneRx 1 pt. 7,569

  1. Avatar for dbuske 131. dbuske Lv 1 3 pts. 8,180
  2. Avatar for nedi 132. nedi Lv 1 3 pts. 8,154
  3. Avatar for Graham MF 133. Graham MF Lv 1 3 pts. 8,146
  4. Avatar for bwkittitas 134. bwkittitas Lv 1 3 pts. 8,129
  5. Avatar for Jajaboman 135. Jajaboman Lv 1 3 pts. 8,128
  6. Avatar for Punktchen 136. Punktchen Lv 1 3 pts. 8,107
  7. Avatar for perrya 137. perrya Lv 1 2 pts. 8,068
  8. Avatar for Merf 138. Merf Lv 1 2 pts. 8,054
  9. Avatar for dahast.de 139. dahast.de Lv 1 2 pts. 8,050
  10. Avatar for metafolder 140. metafolder Lv 1 2 pts. 8,042

Comments