Placeholder image of a protein
Icon representing a puzzle

1194: Unsolved De-novo Freestyle 69

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
February 13, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DTNEVEKLEKMVREIQKLNGVEIEVERRDNTIRVQLRLDKEEVRIEIRTKEEVIRKVKELFKKIKELVRE

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 13 pts. 8,797
  2. Avatar for xkcd 12. xkcd 10 pts. 8,719
  3. Avatar for It's over 9000! 13. It's over 9000! 7 pts. 8,585
  4. Avatar for Natural Abilities 14. Natural Abilities 6 pts. 8,568
  5. Avatar for SETI.Germany 15. SETI.Germany 4 pts. 8,542
  6. Avatar for freefolder 16. freefolder 3 pts. 8,478
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 2 pts. 8,128
  8. Avatar for CHS SGF,MO 18. CHS SGF,MO 2 pts. 7,624
  9. Avatar for uneRx 20. uneRx 1 pt. 7,569

  1. Avatar for whodiopolis 151. whodiopolis Lv 1 2 pts. 7,767
  2. Avatar for Leath 152. Leath Lv 1 1 pt. 7,731
  3. Avatar for DScott 153. DScott Lv 1 1 pt. 7,710
  4. Avatar for techking45 154. techking45 Lv 1 1 pt. 7,698
  5. Avatar for isantheautumn 155. isantheautumn Lv 1 1 pt. 7,691
  6. Avatar for nagistick 156. nagistick Lv 1 1 pt. 7,684
  7. Avatar for 01010011111 157. 01010011111 Lv 1 1 pt. 7,669
  8. Avatar for Tac1 158. Tac1 Lv 1 1 pt. 7,663
  9. Avatar for GoodGuyGreg 159. GoodGuyGreg Lv 1 1 pt. 7,659
  10. Avatar for bhodg1 160. bhodg1 Lv 1 1 pt. 7,639

Comments