Placeholder image of a protein
Icon representing a puzzle

1194: Unsolved De-novo Freestyle 69

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
February 13, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DTNEVEKLEKMVREIQKLNGVEIEVERRDNTIRVQLRLDKEEVRIEIRTKEEVIRKVKELFKKIKELVRE

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 13 pts. 8,797
  2. Avatar for xkcd 12. xkcd 10 pts. 8,719
  3. Avatar for It's over 9000! 13. It's over 9000! 7 pts. 8,585
  4. Avatar for Natural Abilities 14. Natural Abilities 6 pts. 8,568
  5. Avatar for SETI.Germany 15. SETI.Germany 4 pts. 8,542
  6. Avatar for freefolder 16. freefolder 3 pts. 8,478
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 2 pts. 8,128
  8. Avatar for CHS SGF,MO 18. CHS SGF,MO 2 pts. 7,624
  9. Avatar for uneRx 20. uneRx 1 pt. 7,569

  1. Avatar for momadoc 161. momadoc Lv 1 1 pt. 7,636
  2. Avatar for demeter900 162. demeter900 Lv 1 1 pt. 7,626
  3. Avatar for albertovazquez 163. albertovazquez Lv 1 1 pt. 7,625
  4. Avatar for azndramaholic 164. azndramaholic Lv 1 1 pt. 7,624
  5. Avatar for cnhrcolemam 165. cnhrcolemam Lv 1 1 pt. 7,613
  6. Avatar for pandapharmd 166. pandapharmd Lv 1 1 pt. 7,603
  7. Avatar for Bithalbierer 167. Bithalbierer Lv 1 1 pt. 7,582
  8. Avatar for Jparisi2 168. Jparisi2 Lv 1 1 pt. 7,569
  9. Avatar for maschaefer 169. maschaefer Lv 1 1 pt. 7,559
  10. Avatar for mirjamvandelft 170. mirjamvandelft Lv 1 1 pt. 7,541

Comments