Placeholder image of a protein
Icon representing a puzzle

1194: Unsolved De-novo Freestyle 69

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 13, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DTNEVEKLEKMVREIQKLNGVEIEVERRDNTIRVQLRLDKEEVRIEIRTKEEVIRKVKELFKKIKELVRE

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 13 pts. 8,797
  2. Avatar for xkcd 12. xkcd 10 pts. 8,719
  3. Avatar for It's over 9000! 13. It's over 9000! 7 pts. 8,585
  4. Avatar for Natural Abilities 14. Natural Abilities 6 pts. 8,568
  5. Avatar for SETI.Germany 15. SETI.Germany 4 pts. 8,542
  6. Avatar for freefolder 16. freefolder 3 pts. 8,478
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 2 pts. 8,128
  8. Avatar for CHS SGF,MO 18. CHS SGF,MO 2 pts. 7,624
  9. Avatar for Team Schleswig-Holstein 19. Team Schleswig-Holstein 1 pt. 7,582
  10. Avatar for uneRx 20. uneRx 1 pt. 7,569
  1. Avatar for isaksson 11. isaksson Lv 1 82 pts. 9,238
  2. Avatar for MurloW 12. MurloW Lv 1 80 pts. 9,236
  3. Avatar for Galaxie 13. Galaxie Lv 1 79 pts. 9,219
  4. Avatar for gloverd 14. gloverd Lv 1 77 pts. 9,217
  5. Avatar for pmdpmd 15. pmdpmd Lv 1 75 pts. 9,210
  6. Avatar for spvincent 16. spvincent Lv 1 74 pts. 9,204
  7. Avatar for bendbob 17. bendbob Lv 1 72 pts. 9,201
  8. Avatar for dcrwheeler 18. dcrwheeler Lv 1 71 pts. 9,194
  9. Avatar for Susume 19. Susume Lv 1 69 pts. 9,191
  10. Avatar for bertro 20. bertro Lv 1 68 pts. 9,185

Comments