Placeholder image of a protein
Icon representing a puzzle

1194: Unsolved De-novo Freestyle 69

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
February 13, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DTNEVEKLEKMVREIQKLNGVEIEVERRDNTIRVQLRLDKEEVRIEIRTKEEVIRKVKELFKKIKELVRE

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 13 pts. 8,797
  2. Avatar for xkcd 12. xkcd 10 pts. 8,719
  3. Avatar for It's over 9000! 13. It's over 9000! 7 pts. 8,585
  4. Avatar for Natural Abilities 14. Natural Abilities 6 pts. 8,568
  5. Avatar for SETI.Germany 15. SETI.Germany 4 pts. 8,542
  6. Avatar for freefolder 16. freefolder 3 pts. 8,478
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 2 pts. 8,128
  8. Avatar for CHS SGF,MO 18. CHS SGF,MO 2 pts. 7,624
  9. Avatar for uneRx 20. uneRx 1 pt. 7,569

  1. Avatar for FreeFolder 201. FreeFolder Lv 1 1 pt. 6,388
  2. Avatar for waldo7495 202. waldo7495 Lv 1 1 pt. 6,386
  3. Avatar for Shivine 203. Shivine Lv 1 1 pt. 6,321
  4. Avatar for creativity 204. creativity Lv 1 1 pt. 6,259
  5. Avatar for serg132 205. serg132 Lv 1 1 pt. 6,185
  6. Avatar for StpPls 206. StpPls Lv 1 1 pt. 6,136
  7. Avatar for penteplayer 207. penteplayer Lv 1 1 pt. 6,124
  8. Avatar for leomisso 208. leomisso Lv 1 1 pt. 6,081
  9. Avatar for larry25427 209. larry25427 Lv 1 1 pt. 6,017
  10. Avatar for ChaseLehr1234 210. ChaseLehr1234 Lv 1 1 pt. 5,959

Comments