Placeholder image of a protein
Icon representing a puzzle

1194: Unsolved De-novo Freestyle 69

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 13, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DTNEVEKLEKMVREIQKLNGVEIEVERRDNTIRVQLRLDKEEVRIEIRTKEEVIRKVKELFKKIKELVRE

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 13 pts. 8,797
  2. Avatar for xkcd 12. xkcd 10 pts. 8,719
  3. Avatar for It's over 9000! 13. It's over 9000! 7 pts. 8,585
  4. Avatar for Natural Abilities 14. Natural Abilities 6 pts. 8,568
  5. Avatar for SETI.Germany 15. SETI.Germany 4 pts. 8,542
  6. Avatar for freefolder 16. freefolder 3 pts. 8,478
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 2 pts. 8,128
  8. Avatar for CHS SGF,MO 18. CHS SGF,MO 2 pts. 7,624
  9. Avatar for Team Schleswig-Holstein 19. Team Schleswig-Holstein 1 pt. 7,582
  10. Avatar for uneRx 20. uneRx 1 pt. 7,569
  1. Avatar for pyrimidines 211. pyrimidines Lv 1 1 pt. 5,955
  2. Avatar for EastonSickels1234 212. EastonSickels1234 Lv 1 1 pt. 5,874
  3. Avatar for mpowroznik 213. mpowroznik Lv 1 1 pt. 5,863
  4. Avatar for GreekCivilization 214. GreekCivilization Lv 1 1 pt. 5,861
  5. Avatar for sg159753852654 215. sg159753852654 Lv 1 1 pt. 5,858
  6. Avatar for Andrew.krege 216. Andrew.krege Lv 1 1 pt. 5,858
  7. Avatar for The Wone-abes 217. The Wone-abes Lv 1 1 pt. 5,856
  8. Avatar for zkm 218. zkm Lv 1 1 pt. 5,847
  9. Avatar for fbeast16 219. fbeast16 Lv 1 1 pt. 5,843
  10. Avatar for pw3012 220. pw3012 Lv 1 1 pt. 5,770

Comments