Placeholder image of a protein
Icon representing a puzzle

1194: Unsolved De-novo Freestyle 69

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 13, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DTNEVEKLEKMVREIQKLNGVEIEVERRDNTIRVQLRLDKEEVRIEIRTKEEVIRKVKELFKKIKELVRE

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 13 pts. 8,797
  2. Avatar for xkcd 12. xkcd 10 pts. 8,719
  3. Avatar for It's over 9000! 13. It's over 9000! 7 pts. 8,585
  4. Avatar for Natural Abilities 14. Natural Abilities 6 pts. 8,568
  5. Avatar for SETI.Germany 15. SETI.Germany 4 pts. 8,542
  6. Avatar for freefolder 16. freefolder 3 pts. 8,478
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 2 pts. 8,128
  8. Avatar for CHS SGF,MO 18. CHS SGF,MO 2 pts. 7,624
  9. Avatar for Team Schleswig-Holstein 19. Team Schleswig-Holstein 1 pt. 7,582
  10. Avatar for uneRx 20. uneRx 1 pt. 7,569
  1. Avatar for sandvicl 221. sandvicl Lv 1 1 pt. 5,661
  2. Avatar for luis141097 222. luis141097 Lv 1 1 pt. 5,653
  3. Avatar for Close At Hand 223. Close At Hand Lv 1 1 pt. 5,594
  4. Avatar for Xothothor 224. Xothothor Lv 1 1 pt. 5,592
  5. Avatar for hidijon 225. hidijon Lv 1 1 pt. 5,588
  6. Avatar for axdivide 226. axdivide Lv 1 1 pt. 5,130
  7. Avatar for marsfan 227. marsfan Lv 1 1 pt. 5,130
  8. Avatar for HMK 228. HMK Lv 1 1 pt. 5,130
  9. Avatar for simoniaa 229. simoniaa Lv 1 1 pt. 5,127
  10. Avatar for Quassel 230. Quassel Lv 1 1 pt. 5,117

Comments