Placeholder image of a protein
Icon representing a puzzle

1194: Unsolved De-novo Freestyle 69

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
February 13, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DTNEVEKLEKMVREIQKLNGVEIEVERRDNTIRVQLRLDKEEVRIEIRTKEEVIRKVKELFKKIKELVRE

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 13 pts. 8,797
  2. Avatar for xkcd 12. xkcd 10 pts. 8,719
  3. Avatar for It's over 9000! 13. It's over 9000! 7 pts. 8,585
  4. Avatar for Natural Abilities 14. Natural Abilities 6 pts. 8,568
  5. Avatar for SETI.Germany 15. SETI.Germany 4 pts. 8,542
  6. Avatar for freefolder 16. freefolder 3 pts. 8,478
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 2 pts. 8,128
  8. Avatar for CHS SGF,MO 18. CHS SGF,MO 2 pts. 7,624
  9. Avatar for uneRx 20. uneRx 1 pt. 7,569

  1. Avatar for Museka 31. Museka Lv 1 53 pts. 9,155
  2. Avatar for LociOiling 32. LociOiling Lv 1 52 pts. 9,148
  3. Avatar for crpainter 33. crpainter Lv 1 51 pts. 9,146
  4. Avatar for actiasluna 34. actiasluna Lv 1 50 pts. 9,143
  5. Avatar for Scopper 35. Scopper Lv 1 49 pts. 9,141
  6. Avatar for Timo van der Laan 36. Timo van der Laan Lv 1 48 pts. 9,140
  7. Avatar for nicobul 37. nicobul Lv 1 46 pts. 9,137
  8. Avatar for justjustin 38. justjustin Lv 1 45 pts. 9,137
  9. Avatar for pauldunn 39. pauldunn Lv 1 44 pts. 9,133
  10. Avatar for Aubade01 40. Aubade01 Lv 1 43 pts. 9,128

Comments