Placeholder image of a protein
Icon representing a puzzle

1194: Unsolved De-novo Freestyle 69

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 13, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DTNEVEKLEKMVREIQKLNGVEIEVERRDNTIRVQLRLDKEEVRIEIRTKEEVIRKVKELFKKIKELVRE

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 13 pts. 8,797
  2. Avatar for xkcd 12. xkcd 10 pts. 8,719
  3. Avatar for It's over 9000! 13. It's over 9000! 7 pts. 8,585
  4. Avatar for Natural Abilities 14. Natural Abilities 6 pts. 8,568
  5. Avatar for SETI.Germany 15. SETI.Germany 4 pts. 8,542
  6. Avatar for freefolder 16. freefolder 3 pts. 8,478
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 2 pts. 8,128
  8. Avatar for CHS SGF,MO 18. CHS SGF,MO 2 pts. 7,624
  9. Avatar for Team Schleswig-Holstein 19. Team Schleswig-Holstein 1 pt. 7,582
  10. Avatar for uneRx 20. uneRx 1 pt. 7,569
  1. Avatar for christioanchauvin 51. christioanchauvin Lv 1 33 pts. 9,043
  2. Avatar for phi16 52. phi16 Lv 1 32 pts. 9,039
  3. Avatar for gurch 53. gurch Lv 1 32 pts. 9,007
  4. Avatar for tarquilu 54. tarquilu Lv 1 31 pts. 9,005
  5. Avatar for cbwest 55. cbwest Lv 1 30 pts. 8,993
  6. Avatar for Bletchley Park 56. Bletchley Park Lv 1 29 pts. 8,986
  7. Avatar for adelelopez 57. adelelopez Lv 1 29 pts. 8,978
  8. Avatar for jamiexq 58. jamiexq Lv 1 28 pts. 8,966
  9. Avatar for ViJay7019 59. ViJay7019 Lv 1 27 pts. 8,964
  10. Avatar for Glen B 60. Glen B Lv 1 27 pts. 8,960

Comments