Placeholder image of a protein
Icon representing a puzzle

1194: Unsolved De-novo Freestyle 69

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
February 13, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DTNEVEKLEKMVREIQKLNGVEIEVERRDNTIRVQLRLDKEEVRIEIRTKEEVIRKVKELFKKIKELVRE

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 13 pts. 8,797
  2. Avatar for xkcd 12. xkcd 10 pts. 8,719
  3. Avatar for It's over 9000! 13. It's over 9000! 7 pts. 8,585
  4. Avatar for Natural Abilities 14. Natural Abilities 6 pts. 8,568
  5. Avatar for SETI.Germany 15. SETI.Germany 4 pts. 8,542
  6. Avatar for freefolder 16. freefolder 3 pts. 8,478
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 2 pts. 8,128
  8. Avatar for CHS SGF,MO 18. CHS SGF,MO 2 pts. 7,624
  9. Avatar for uneRx 20. uneRx 1 pt. 7,569

  1. Avatar for Vinara 61. Vinara Lv 1 26 pts. 8,930
  2. Avatar for joremen 62. joremen Lv 1 25 pts. 8,929
  3. Avatar for WarpSpeed 63. WarpSpeed Lv 1 25 pts. 8,928
  4. Avatar for goastano 64. goastano Lv 1 24 pts. 8,923
  5. Avatar for shettler 65. shettler Lv 1 23 pts. 8,912
  6. Avatar for Bautho 66. Bautho Lv 1 23 pts. 8,910
  7. Avatar for WBarme1234 67. WBarme1234 Lv 1 22 pts. 8,897
  8. Avatar for Flagg65a 68. Flagg65a Lv 1 22 pts. 8,897
  9. Avatar for SKSbell 69. SKSbell Lv 1 21 pts. 8,889
  10. Avatar for pmthomson90 70. pmthomson90 Lv 1 20 pts. 8,870

Comments