Placeholder image of a protein
Icon representing a puzzle

1194: Unsolved De-novo Freestyle 69

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 13, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DTNEVEKLEKMVREIQKLNGVEIEVERRDNTIRVQLRLDKEEVRIEIRTKEEVIRKVKELFKKIKELVRE

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 13 pts. 8,797
  2. Avatar for xkcd 12. xkcd 10 pts. 8,719
  3. Avatar for It's over 9000! 13. It's over 9000! 7 pts. 8,585
  4. Avatar for Natural Abilities 14. Natural Abilities 6 pts. 8,568
  5. Avatar for SETI.Germany 15. SETI.Germany 4 pts. 8,542
  6. Avatar for freefolder 16. freefolder 3 pts. 8,478
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 2 pts. 8,128
  8. Avatar for CHS SGF,MO 18. CHS SGF,MO 2 pts. 7,624
  9. Avatar for Team Schleswig-Holstein 19. Team Schleswig-Holstein 1 pt. 7,582
  10. Avatar for uneRx 20. uneRx 1 pt. 7,569
  1. Avatar for YeshuaLives 71. YeshuaLives Lv 1 20 pts. 8,870
  2. Avatar for alwen 72. alwen Lv 1 19 pts. 8,868
  3. Avatar for guineapig 73. guineapig Lv 1 19 pts. 8,858
  4. Avatar for YGK 74. YGK Lv 1 18 pts. 8,857
  5. Avatar for Satina 75. Satina Lv 1 18 pts. 8,844
  6. Avatar for caglar 76. caglar Lv 1 17 pts. 8,824
  7. Avatar for tallguy-13088 77. tallguy-13088 Lv 1 17 pts. 8,824
  8. Avatar for alcor29 78. alcor29 Lv 1 16 pts. 8,823
  9. Avatar for andrewxc 79. andrewxc Lv 1 16 pts. 8,822
  10. Avatar for smilingone 80. smilingone Lv 1 15 pts. 8,821

Comments