Placeholder image of a protein
Icon representing a puzzle

1194: Unsolved De-novo Freestyle 69

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 13, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DTNEVEKLEKMVREIQKLNGVEIEVERRDNTIRVQLRLDKEEVRIEIRTKEEVIRKVKELFKKIKELVRE

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 13 pts. 8,797
  2. Avatar for xkcd 12. xkcd 10 pts. 8,719
  3. Avatar for It's over 9000! 13. It's over 9000! 7 pts. 8,585
  4. Avatar for Natural Abilities 14. Natural Abilities 6 pts. 8,568
  5. Avatar for SETI.Germany 15. SETI.Germany 4 pts. 8,542
  6. Avatar for freefolder 16. freefolder 3 pts. 8,478
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 2 pts. 8,128
  8. Avatar for CHS SGF,MO 18. CHS SGF,MO 2 pts. 7,624
  9. Avatar for Team Schleswig-Holstein 19. Team Schleswig-Holstein 1 pt. 7,582
  10. Avatar for uneRx 20. uneRx 1 pt. 7,569
  1. Avatar for Crossed Sticks 81. Crossed Sticks Lv 1 15 pts. 8,816
  2. Avatar for diamonddays 82. diamonddays Lv 1 15 pts. 8,816
  3. Avatar for kitek314_pl 83. kitek314_pl Lv 1 14 pts. 8,797
  4. Avatar for manu8170 84. manu8170 Lv 1 14 pts. 8,760
  5. Avatar for Soggy Doglog 85. Soggy Doglog Lv 1 13 pts. 8,758
  6. Avatar for Franco Padelletti 86. Franco Padelletti Lv 1 13 pts. 8,757
  7. Avatar for pvc78 87. pvc78 Lv 1 13 pts. 8,755
  8. Avatar for Giant Berk 88. Giant Berk Lv 1 12 pts. 8,739
  9. Avatar for navn 89. navn Lv 1 12 pts. 8,733
  10. Avatar for fryguy 90. fryguy Lv 1 12 pts. 8,719

Comments