Placeholder image of a protein
Icon representing a puzzle

1194: Unsolved De-novo Freestyle 69

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
February 13, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DTNEVEKLEKMVREIQKLNGVEIEVERRDNTIRVQLRLDKEEVRIEIRTKEEVIRKVKELFKKIKELVRE

Top groups


  1. Avatar for Deleted group 22. Deleted group pts. 6,999
  2. Avatar for Deleted group 24. Deleted group pts. 6,740
  3. Avatar for Team South Africa 25. Team South Africa 1 pt. 6,493
  4. Avatar for USD_IMB 27. USD_IMB 1 pt. 5,955
  5. Avatar for Something Witty 28. Something Witty 1 pt. 5,770
  6. Avatar for Rechenkraft.net 29. Rechenkraft.net 1 pt. 5,130
  7. Avatar for DSN @ Home 30. DSN @ Home 1 pt. 0

  1. Avatar for Blipperman
    1. Blipperman Lv 1
    100 pts. 9,421
  2. Avatar for actiasluna 2. actiasluna Lv 1 89 pts. 9,419
  3. Avatar for Skippysk8s 3. Skippysk8s Lv 1 78 pts. 9,416
  4. Avatar for diamond_dust 4. diamond_dust Lv 1 68 pts. 9,416
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 60 pts. 9,415
  6. Avatar for ManVsYard 6. ManVsYard Lv 1 52 pts. 9,415
  7. Avatar for andrewxc 7. andrewxc Lv 1 45 pts. 9,414
  8. Avatar for Cyberkashi 8. Cyberkashi Lv 1 39 pts. 9,412
  9. Avatar for pauldunn 9. pauldunn Lv 1 33 pts. 9,406
  10. Avatar for gloverd 10. gloverd Lv 1 28 pts. 9,390

Comments