Placeholder image of a protein
Icon representing a puzzle

1194: Unsolved De-novo Freestyle 69

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
February 13, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DTNEVEKLEKMVREIQKLNGVEIEVERRDNTIRVQLRLDKEEVRIEIRTKEEVIRKVKELFKKIKELVRE

Top groups


  1. Avatar for Deleted group 22. Deleted group pts. 6,999
  2. Avatar for Deleted group 24. Deleted group pts. 6,740
  3. Avatar for Team South Africa 25. Team South Africa 1 pt. 6,493
  4. Avatar for USD_IMB 27. USD_IMB 1 pt. 5,955
  5. Avatar for Something Witty 28. Something Witty 1 pt. 5,770
  6. Avatar for Rechenkraft.net 29. Rechenkraft.net 1 pt. 5,130
  7. Avatar for DSN @ Home 30. DSN @ Home 1 pt. 0

  1. Avatar for mitarcher 141. mitarcher Lv 1 2 pts. 8,010
  2. Avatar for martinf 142. martinf Lv 1 2 pts. 7,984
  3. Avatar for Primalsoul 143. Primalsoul Lv 1 2 pts. 7,915
  4. Avatar for lamoille 144. lamoille Lv 1 2 pts. 7,913
  5. Avatar for tsarsaltin 145. tsarsaltin Lv 1 2 pts. 7,890
  6. Avatar for parsnip 146. parsnip Lv 1 2 pts. 7,836
  7. Avatar for hallenberg 147. hallenberg Lv 1 2 pts. 7,817
  8. Avatar for brgreening 148. brgreening Lv 1 2 pts. 7,795
  9. Avatar for Cerzax 149. Cerzax Lv 1 2 pts. 7,785
  10. Avatar for hada 150. hada Lv 1 2 pts. 7,779

Comments