Placeholder image of a protein
Icon representing a puzzle

1194: Unsolved De-novo Freestyle 69

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
February 13, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DTNEVEKLEKMVREIQKLNGVEIEVERRDNTIRVQLRLDKEEVRIEIRTKEEVIRKVKELFKKIKELVRE

Top groups


  1. Avatar for Deleted group 22. Deleted group pts. 6,999
  2. Avatar for Deleted group 24. Deleted group pts. 6,740
  3. Avatar for Team South Africa 25. Team South Africa 1 pt. 6,493
  4. Avatar for USD_IMB 27. USD_IMB 1 pt. 5,955
  5. Avatar for Something Witty 28. Something Witty 1 pt. 5,770
  6. Avatar for Rechenkraft.net 29. Rechenkraft.net 1 pt. 5,130
  7. Avatar for DSN @ Home 30. DSN @ Home 1 pt. 0

  1. Avatar for whodiopolis 151. whodiopolis Lv 1 2 pts. 7,767
  2. Avatar for Leath 152. Leath Lv 1 1 pt. 7,731
  3. Avatar for DScott 153. DScott Lv 1 1 pt. 7,710
  4. Avatar for techking45 154. techking45 Lv 1 1 pt. 7,698
  5. Avatar for isantheautumn 155. isantheautumn Lv 1 1 pt. 7,691
  6. Avatar for nagistick 156. nagistick Lv 1 1 pt. 7,684
  7. Avatar for 01010011111 157. 01010011111 Lv 1 1 pt. 7,669
  8. Avatar for Tac1 158. Tac1 Lv 1 1 pt. 7,663
  9. Avatar for GoodGuyGreg 159. GoodGuyGreg Lv 1 1 pt. 7,659
  10. Avatar for bhodg1 160. bhodg1 Lv 1 1 pt. 7,639

Comments