Placeholder image of a protein
Icon representing a puzzle

1194: Unsolved De-novo Freestyle 69

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
February 13, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DTNEVEKLEKMVREIQKLNGVEIEVERRDNTIRVQLRLDKEEVRIEIRTKEEVIRKVKELFKKIKELVRE

Top groups


  1. Avatar for Deleted group 22. Deleted group pts. 6,999
  2. Avatar for Deleted group 24. Deleted group pts. 6,740
  3. Avatar for Team South Africa 25. Team South Africa 1 pt. 6,493
  4. Avatar for USD_IMB 27. USD_IMB 1 pt. 5,955
  5. Avatar for Something Witty 28. Something Witty 1 pt. 5,770
  6. Avatar for Rechenkraft.net 29. Rechenkraft.net 1 pt. 5,130
  7. Avatar for DSN @ Home 30. DSN @ Home 1 pt. 0

  1. Avatar for sandvicl 221. sandvicl Lv 1 1 pt. 5,661
  2. Avatar for luis141097 222. luis141097 Lv 1 1 pt. 5,653
  3. Avatar for Close At Hand 223. Close At Hand Lv 1 1 pt. 5,594
  4. Avatar for Xothothor 224. Xothothor Lv 1 1 pt. 5,592
  5. Avatar for hidijon 225. hidijon Lv 1 1 pt. 5,588
  6. Avatar for axdivide 226. axdivide Lv 1 1 pt. 5,130
  7. Avatar for marsfan 227. marsfan Lv 1 1 pt. 5,130
  8. Avatar for HMK 228. HMK Lv 1 1 pt. 5,130
  9. Avatar for simoniaa 229. simoniaa Lv 1 1 pt. 5,127
  10. Avatar for Quassel 230. Quassel Lv 1 1 pt. 5,117

Comments