Placeholder image of a protein
Icon representing a puzzle

1194: Unsolved De-novo Freestyle 69

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 13, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DTNEVEKLEKMVREIQKLNGVEIEVERRDNTIRVQLRLDKEEVRIEIRTKEEVIRKVKELFKKIKELVRE

Top groups

  1. Avatar for Piratenpartei Deutschland 21. Piratenpartei Deutschland 1 pt. 7,160
  2. Avatar for Deleted group 22. Deleted group pts. 6,999
  3. Avatar for Dr. Short's Molecular Lab 23. Dr. Short's Molecular Lab 1 pt. 6,994
  4. Avatar for Deleted group 24. Deleted group pts. 6,740
  5. Avatar for Team South Africa 25. Team South Africa 1 pt. 6,493
  6. Avatar for Ms. Carter's Jr. Science Classes 26. Ms. Carter's Jr. Science Classes 1 pt. 5,959
  7. Avatar for USD_IMB 27. USD_IMB 1 pt. 5,955
  8. Avatar for Something Witty 28. Something Witty 1 pt. 5,770
  9. Avatar for Rechenkraft.net 29. Rechenkraft.net 1 pt. 5,130
  10. Avatar for DSN @ Home 30. DSN @ Home 1 pt. 0
  1. Avatar for christioanchauvin 51. christioanchauvin Lv 1 33 pts. 9,043
  2. Avatar for phi16 52. phi16 Lv 1 32 pts. 9,039
  3. Avatar for gurch 53. gurch Lv 1 32 pts. 9,007
  4. Avatar for tarquilu 54. tarquilu Lv 1 31 pts. 9,005
  5. Avatar for cbwest 55. cbwest Lv 1 30 pts. 8,993
  6. Avatar for Bletchley Park 56. Bletchley Park Lv 1 29 pts. 8,986
  7. Avatar for adelelopez 57. adelelopez Lv 1 29 pts. 8,978
  8. Avatar for jamiexq 58. jamiexq Lv 1 28 pts. 8,966
  9. Avatar for ViJay7019 59. ViJay7019 Lv 1 27 pts. 8,964
  10. Avatar for Glen B 60. Glen B Lv 1 27 pts. 8,960

Comments