Placeholder image of a protein
Icon representing a puzzle

1194: Unsolved De-novo Freestyle 69

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
February 13, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DTNEVEKLEKMVREIQKLNGVEIEVERRDNTIRVQLRLDKEEVRIEIRTKEEVIRKVKELFKKIKELVRE

Top groups


  1. Avatar for Deleted group 22. Deleted group pts. 6,999
  2. Avatar for Deleted group 24. Deleted group pts. 6,740
  3. Avatar for Team South Africa 25. Team South Africa 1 pt. 6,493
  4. Avatar for USD_IMB 27. USD_IMB 1 pt. 5,955
  5. Avatar for Something Witty 28. Something Witty 1 pt. 5,770
  6. Avatar for Rechenkraft.net 29. Rechenkraft.net 1 pt. 5,130
  7. Avatar for DSN @ Home 30. DSN @ Home 1 pt. 0

  1. Avatar for YeshuaLives 71. YeshuaLives Lv 1 20 pts. 8,870
  2. Avatar for alwen 72. alwen Lv 1 19 pts. 8,868
  3. Avatar for guineapig 73. guineapig Lv 1 19 pts. 8,858
  4. Avatar for YGK 74. YGK Lv 1 18 pts. 8,857
  5. Avatar for Satina 75. Satina Lv 1 18 pts. 8,844
  6. Avatar for caglar 76. caglar Lv 1 17 pts. 8,824
  7. Avatar for tallguy-13088 77. tallguy-13088 Lv 1 17 pts. 8,824
  8. Avatar for alcor29 78. alcor29 Lv 1 16 pts. 8,823
  9. Avatar for andrewxc 79. andrewxc Lv 1 16 pts. 8,822
  10. Avatar for smilingone 80. smilingone Lv 1 15 pts. 8,821

Comments