Placeholder image of a protein
Icon representing a puzzle

1194: Unsolved De-novo Freestyle 69

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
February 13, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DTNEVEKLEKMVREIQKLNGVEIEVERRDNTIRVQLRLDKEEVRIEIRTKEEVIRKVKELFKKIKELVRE

Top groups


  1. Avatar for Gargleblasters 100 pts. 9,421
  2. Avatar for Go Science 2. Go Science 84 pts. 9,416
  3. Avatar for Contenders 3. Contenders 70 pts. 9,374
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 58 pts. 9,335
  5. Avatar for Beta Folders 5. Beta Folders 48 pts. 9,324
  6. Avatar for HMT heritage 6. HMT heritage 39 pts. 9,277
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 32 pts. 9,210
  8. Avatar for Void Crushers 8. Void Crushers 26 pts. 9,173
  9. Avatar for Deleted group 9. Deleted group pts. 9,060
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 16 pts. 8,870

  1. Avatar for schwalal 251. schwalal Lv 1 1 pt. 0

Comments