Placeholder image of a protein
Icon representing a puzzle

1194: Unsolved De-novo Freestyle 69

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 13, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


DTNEVEKLEKMVREIQKLNGVEIEVERRDNTIRVQLRLDKEEVRIEIRTKEEVIRKVKELFKKIKELVRE

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 9,421
  2. Avatar for Go Science 2. Go Science 84 pts. 9,416
  3. Avatar for Contenders 3. Contenders 70 pts. 9,374
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 58 pts. 9,335
  5. Avatar for Beta Folders 5. Beta Folders 48 pts. 9,324
  6. Avatar for HMT heritage 6. HMT heritage 39 pts. 9,277
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 32 pts. 9,210
  8. Avatar for Void Crushers 8. Void Crushers 26 pts. 9,173
  9. Avatar for Deleted group 9. Deleted group pts. 9,060
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 16 pts. 8,870
  1. Avatar for jobo0502 41. jobo0502 Lv 1 42 pts. 9,126
  2. Avatar for gitwut 42. gitwut Lv 1 41 pts. 9,113
  3. Avatar for Skippysk8s 43. Skippysk8s Lv 1 40 pts. 9,092
  4. Avatar for Blipperman 44. Blipperman Lv 1 39 pts. 9,081
  5. Avatar for johnmitch 45. johnmitch Lv 1 38 pts. 9,067
  6. Avatar for Madde 46. Madde Lv 1 38 pts. 9,062
  7. Avatar for hansvandenhof 47. hansvandenhof Lv 1 37 pts. 9,062
  8. Avatar for drumpeter18yrs9yrs 48. drumpeter18yrs9yrs Lv 1 36 pts. 9,060
  9. Avatar for g_b 49. g_b Lv 1 35 pts. 9,054
  10. Avatar for Anfinsen_slept_here 50. Anfinsen_slept_here Lv 1 34 pts. 9,054

Comments