Placeholder image of a protein
Icon representing a puzzle

1197: Unsolved De-novo Freestyle 70

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 20, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TLDEIEKEIRKWLSQNRTGNLEKRDGELRLEVNNTELRITEGVHREQVKEELKKMEKQHN

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,840
  2. Avatar for xkcd 12. xkcd 1 pt. 8,788
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,653
  4. Avatar for freefolder 14. freefolder 1 pt. 8,249
  5. Avatar for 2015-6 Biochemistry: Drugs and Poisons 15. 2015-6 Biochemistry: Drugs and Poisons 1 pt. 8,210
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,057
  7. Avatar for Deleted group 17. Deleted group pts. 6,257
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 5,810
  1. Avatar for Skippysk8s
    1. Skippysk8s Lv 1
    100 pts. 9,325
  2. Avatar for actiasluna 2. actiasluna Lv 1 89 pts. 9,325
  3. Avatar for Blipperman 3. Blipperman Lv 1 78 pts. 9,325
  4. Avatar for ManVsYard 4. ManVsYard Lv 1 68 pts. 9,322
  5. Avatar for Norrjane 5. Norrjane Lv 1 60 pts. 9,321
  6. Avatar for frood66 6. frood66 Lv 1 52 pts. 9,319
  7. Avatar for dbuske 7. dbuske Lv 1 45 pts. 9,317
  8. Avatar for Galaxie 8. Galaxie Lv 1 39 pts. 9,310
  9. Avatar for bendbob 9. bendbob Lv 1 33 pts. 9,310
  10. Avatar for gmn 10. gmn Lv 1 28 pts. 9,307

Comments