Placeholder image of a protein
Icon representing a puzzle

1197: Unsolved De-novo Freestyle 70

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 20, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TLDEIEKEIRKWLSQNRTGNLEKRDGELRLEVNNTELRITEGVHREQVKEELKKMEKQHN

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,840
  2. Avatar for xkcd 12. xkcd 1 pt. 8,788
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,653
  4. Avatar for freefolder 14. freefolder 1 pt. 8,249
  5. Avatar for 2015-6 Biochemistry: Drugs and Poisons 15. 2015-6 Biochemistry: Drugs and Poisons 1 pt. 8,210
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,057
  7. Avatar for Deleted group 17. Deleted group pts. 6,257
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 5,810
  1. Avatar for deLaCeiba 91. deLaCeiba Lv 1 10 pts. 8,631
  2. Avatar for harvardman 92. harvardman Lv 1 9 pts. 8,626
  3. Avatar for Schnurri 93. Schnurri Lv 1 9 pts. 8,626
  4. Avatar for caglar 94. caglar Lv 1 9 pts. 8,610
  5. Avatar for YGK 95. YGK Lv 1 8 pts. 8,591
  6. Avatar for Psych0Active 96. Psych0Active Lv 1 8 pts. 8,585
  7. Avatar for Superphosphate 97. Superphosphate Lv 1 8 pts. 8,575
  8. Avatar for Crossed Sticks 98. Crossed Sticks Lv 1 8 pts. 8,570
  9. Avatar for Jim Fraser 99. Jim Fraser Lv 1 7 pts. 8,565
  10. Avatar for tallguy-13088 100. tallguy-13088 Lv 1 7 pts. 8,562

Comments