Placeholder image of a protein
Icon representing a puzzle

1197: Unsolved De-novo Freestyle 70

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 20, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TLDEIEKEIRKWLSQNRTGNLEKRDGELRLEVNNTELRITEGVHREQVKEELKKMEKQHN

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,840
  2. Avatar for xkcd 12. xkcd 1 pt. 8,788
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,653
  4. Avatar for freefolder 14. freefolder 1 pt. 8,249
  5. Avatar for 2015-6 Biochemistry: Drugs and Poisons 15. 2015-6 Biochemistry: Drugs and Poisons 1 pt. 8,210
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,057
  7. Avatar for Deleted group 17. Deleted group pts. 6,257
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 5,810
  1. Avatar for GoodGuyGreg 131. GoodGuyGreg Lv 1 2 pts. 8,188
  2. Avatar for lange 132. lange Lv 1 2 pts. 8,161
  3. Avatar for arortiz73 133. arortiz73 Lv 1 2 pts. 8,138
  4. Avatar for Iron pet 134. Iron pet Lv 1 2 pts. 8,133
  5. Avatar for ragadhousni 135. ragadhousni Lv 1 2 pts. 8,127
  6. Avatar for bwkittitas 136. bwkittitas Lv 1 2 pts. 8,085
  7. Avatar for Jajaboman 137. Jajaboman Lv 1 2 pts. 8,057
  8. Avatar for Dantoto 138. Dantoto Lv 1 2 pts. 8,041
  9. Avatar for TheStaticSloth 139. TheStaticSloth Lv 1 2 pts. 8,020
  10. Avatar for parsnip 140. parsnip Lv 1 2 pts. 7,981

Comments