Placeholder image of a protein
Icon representing a puzzle

1197: Unsolved De-novo Freestyle 70

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
February 20, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TLDEIEKEIRKWLSQNRTGNLEKRDGELRLEVNNTELRITEGVHREQVKEELKKMEKQHN

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 8,840
  2. Avatar for xkcd 12. xkcd 1 pt. 8,788
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,653
  4. Avatar for freefolder 14. freefolder 1 pt. 8,249
  5. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,057
  6. Avatar for Deleted group 17. Deleted group pts. 6,257
  7. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 5,810

  1. Avatar for mirjamvandelft 181. mirjamvandelft Lv 1 1 pt. 7,401
  2. Avatar for isantheautumn 182. isantheautumn Lv 1 1 pt. 7,386
  3. Avatar for TJOK fan 184. TJOK fan Lv 1 1 pt. 7,286
  4. Avatar for NotJim99 185. NotJim99 Lv 1 1 pt. 7,285
  5. Avatar for taniks 186. taniks Lv 1 1 pt. 7,276
  6. Avatar for 341441 187. 341441 Lv 1 1 pt. 7,229
  7. Avatar for DScott 188. DScott Lv 1 1 pt. 7,219
  8. Avatar for Truncheon Luncheon 189. Truncheon Luncheon Lv 1 1 pt. 7,165
  9. Avatar for pandabearsecond 190. pandabearsecond Lv 1 1 pt. 7,156

Comments