Placeholder image of a protein
Icon representing a puzzle

1197: Unsolved De-novo Freestyle 70

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 20, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TLDEIEKEIRKWLSQNRTGNLEKRDGELRLEVNNTELRITEGVHREQVKEELKKMEKQHN

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,840
  2. Avatar for xkcd 12. xkcd 1 pt. 8,788
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,653
  4. Avatar for freefolder 14. freefolder 1 pt. 8,249
  5. Avatar for 2015-6 Biochemistry: Drugs and Poisons 15. 2015-6 Biochemistry: Drugs and Poisons 1 pt. 8,210
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,057
  7. Avatar for Deleted group 17. Deleted group pts. 6,257
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 5,810
  1. Avatar for copy0660 201. copy0660 Lv 1 1 pt. 6,522
  2. Avatar for StpPls 202. StpPls Lv 1 1 pt. 6,461
  3. Avatar for marie.c 203. marie.c Lv 1 1 pt. 6,451
  4. Avatar for SnoopySnoopy 204. SnoopySnoopy Lv 1 1 pt. 6,405
  5. Avatar for Yarima2 205. Yarima2 Lv 1 1 pt. 6,374
  6. Avatar for zkm 206. zkm Lv 1 1 pt. 6,372
  7. Avatar for majires 207. majires Lv 1 1 pt. 6,369
  8. Avatar for eunjun08 208. eunjun08 Lv 1 1 pt. 6,368
  9. Avatar for Mead King 209. Mead King Lv 1 1 pt. 6,321
  10. Avatar for jjakowiecki 210. jjakowiecki Lv 1 1 pt. 6,298

Comments